-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRCP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 407-496 of human PRCP (NP_005031.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRCP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 407-496 of human PRCP (NP_005031.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04019A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRCP |
| Target Synonyms | PCP; HUMPCP; PRCP | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 407-496 of human PRCP (NP_005031.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ITTMYGGKNISSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYDSAGKQH | Uniprot ID | P42785 |
Uniprot Id
P42785
Target Species
Human
Target Name
PRCP
Target Full Name
Lysosomal Pro-X carboxypeptidase
Target Function
Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.
Target Subcellular Location
Lysosome.
Target Protein Families
Peptidase S28 family
Target Tissue Specificity
Highest levels in placenta, lung and liver. Also present in heart, brain, pancreas and kidney.
Target Synonyms
Angiotensinase C; HUMPCP ; Lysosomal carboxypeptidase C; Lysosomal Pro X carboxypeptidase; Lysosomal Pro-X carboxypeptidase; MGC2202; PCP ; PCP_HUMAN; PRCP; Proline carboxypeptidase; Prolylcarboxypeptidase (angiotensinase C); Prolylcarboxypeptidase; prolylcarboxypeptidase isoform 1 preproprotein
Target Background
This gene encodes a member of the peptidase S28 family of serine exopeptidases. The encoded preproprotein is proteolytically processed to generate the mature lysosomal prolylcarboxypeptidase. This enzyme cleaves C-terminal amino acids linked to proline in peptides such as angiotension II, III and des-Arg9-bradykinin. The cleavage occurs at acidic pH, but the enzyme activity is retained with some substrates at neutral pH. This enzyme has been shown to be an activator of the cell matrix-associated prekallikrein. The importance of angiotension II, one of the substrates of this enzyme, in regulating blood pressure and electrolyte balance suggests that this gene may be related to essential hypertension. A pseudogene of this gene has been identified on chromosome 2. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Notification