Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PUMA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-131 of human PUMA (NP_001120713.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PUMA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-131 of human PUMA (NP_001120713.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10270A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PUMA |
| Target Synonyms | JFY1; PUMA; JFY-1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, K562, LO2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-131 of human PUMA (NP_001120713.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN | Uniprot ID | Q96PG8, Q9BXH1 |
Uniprot Id
Q96PG8, Q9BXH1
Target Synonyms
JFY1; PUMA; JFY-1
Target Background
This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
