-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBMX/hnRNP G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RBMX/hnRNP G (NP_002130.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RBMX/hnRNP G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RBMX/hnRNP G (NP_002130.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05060A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBMX/hnRNP G |
| Target Synonyms | RNMX; HNRPG; HNRNPG; MRXS11; RBMXP1; RBMXRT; hnRNP-G; RBMX/hnRNP G | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RBMX/hnRNP G (NP_002130.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG | Uniprot ID | P38159 |
Uniprot Id
P38159
Target Species
Human
Target Name
RBMX
Target Full Name
RNA-binding motif protein, X chromosome
Target Function
RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of several pre-mRNAs. Binds to and stimulates transcription from the tumor suppressor TXNIP gene promoter; may thus be involved in tumor suppression. When associated with SAFB, binds to and stimulates transcription from the SREBF1 promoter. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Can either activate or suppress exon inclusion; acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially to single-stranded 5'-CC[A/C]-rich RNA sequence motifs localized in a single-stranded conformation; probably binds RNA as a homodimer. Binds non-specifically to pre-mRNAs. Plays also a role in the cytoplasmic TNFR1 trafficking pathways; promotes both the IL-1-beta-mediated inducible proteolytic cleavage of TNFR1 ectodomains and the release of TNFR1 exosome-like vesicles to the extracellular compartment.
Target Involvement
Mental retardation, X-linked, syndromic, 11 (MRXS11)
Target Subcellular Location
Nucleus. Note=Component of ribonucleosomes. Localizes in numerous small granules in the nucleus.
Target Tissue Specificity
Expressed strongly in oral keratinocytes, but only weakly detected in oral squamous cell carcinomas (at protein level).
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
RBMX; HNRPG; RBMXP1; RNA-binding motif protein; X chromosome; Glycoprotein p43; Heterogeneous nuclear ribonucleoprotein G; hnRNP G) [Cleaved into: RNA-binding motif protein; X chromosome; N-terminally processed]
Target Background
This gene belongs to the RBMY gene family which includes candidate Y chromosome spermatogenesis genes. This gene, an active X chromosome homolog of the Y chromosome RBMY gene, is widely expressed whereas the RBMY gene evolved a male-specific function in spermatogenesis. Pseudogenes of this gene, found on chromosomes 1, 4, 9, 11, and 6, were likely derived by retrotransposition from the original gene. Alternatively spliced transcript variants encoding different isoforms have been identified. A snoRNA gene (SNORD61) is found in one of its introns.
Notification