-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RCAN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-245 of human RCAN1 (NP_004405.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RCAN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-245 of human RCAN1 (NP_004405.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11209A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RCAN1 |
| Target Synonyms | CSP1; DSC1; RCN1; DSCR1; MCIP1; ADAPT78; RCAN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SKOV3, SW480, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-245 of human RCAN1 (NP_004405.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPE | Uniprot ID | P53805 |
Uniprot Id
P53805
Target Species
Human
Target Name
RCAN1
Target Full Name
Calcipressin-1
Target Function
Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development.
Target Protein Families
RCAN family
Target Tissue Specificity
Highly expressed heart, brain and skeletal muscle. Also expressed in all other tissues.
Target Synonyms
Adapt 78; Adapt78; Calcipressin 1; Calcipressin-1; Calcium and oxidant inducible mRNA; CSP 1; CSP1; Down syndrome candidate region 1; Down syndrome critical region gene 1; Down syndrome critical region protein 1; DSC 1; DSC1; DSCR 1; DSCR1; MCIP 1; MCIP1; Modulatory calcineurin interacting protein 1; Myocyte enriched calcineurin interacting protein 1; Myocyte-enriched calcineurin-interacting protein 1; Near DSCR proline rich protein; RCAN1; RCAN1_HUMAN; RCN 1; RCN1; Regulator of calcineurin 1
Target Background
The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants.
Notification