Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPP21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human RPP21 (NP_079115.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPP21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human RPP21 (NP_079115.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05648A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPP21 |
| Target Synonyms | CAT60; C6orf135; RPP21 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human RPP21 (NP_079115.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ | Uniprot ID | Q9H633 |
Uniprot Id
Q9H633
Target Species
Human
Target Name
RPP21
Target Full Name
Ribonuclease P protein subunit p21
Target Function
Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
Eukaryotic/archaeal RNase P protein component 4 family
Target Synonyms
RPP21; C6orf135; CAT60; Ribonuclease P protein subunit p21; RNaseP protein p21; EC 3.1.26.5; Ribonuclease P/MRP 21 kDa subunit; Ribonucleoprotein V
Target Background
RPP21 is a protein subunit of nuclear ribonuclease P, which processes the 5-prime leader sequence of precursor tRNAs (Jarrous et al., 2001 [PubMed 11497433]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
