-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100A10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A10 (NP_002957.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against S100A10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A10 (NP_002957.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00630A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100A10 |
| Target Synonyms | 42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG; S100A10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A10 (NP_002957.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK | Uniprot ID | P60903 |
Uniprot Id
P60903
Target Species
Human
Target Name
S100A10
Target Full Name
Protein S100-A10
Target Function
Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
Target Protein Families
S-100 family
Target Research Area
Signal Transduction
Target Synonyms
42C; AA409961; AL024248; Annexin II ligand; Annexin II ligand; calpactin I; light polypeptide ; Annexin II tetramer (AIIt) p11 subunit; Annexin II; light chain; ANX2L ; ANX2LG ; Ca[1] ; CAL12; CAL1L ; Calpactin I light chain; Calpactin I; p11 subunit; Calpactin-1 light chain; Cellular ligand of annexin II; CLP11 ; GP11 ; MGC111133 ; Nerve growth factor-induced protein 42C; OTTHUMP00000015269 ; OTTHUMP00000015270 ; p10 ; p10 protein; p11; Protein S100 A10; Protein S100-A10; S100 calcium binding protein A10 (annexin II ligand; calpactin I; light polypeptide (p11)) ; S100 calcium binding protein A10 (calpactin); S100 calcium binding protein A10; S100 calcium-binding protein A10; S100a10; S10AA_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.
Notification