-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Septin 6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-434 of human Septin 6 (NP_055944.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Septin 6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-434 of human Septin 6 (NP_055944.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06831A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Septin 6 |
| Target Synonyms | SEP2; SEPT2; SEPT6; Septin 6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-434 of human Septin 6 (NP_055944.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLKRDKEKKNNPWLCTE | Uniprot ID | Q14141 |
Uniprot Id
Q14141
Target Species
Human
Target Name
SEPT6
Target Full Name
Septin-6
Target Function
Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Involved in cytokinesis. May play a role in HCV RNA replication. Forms a filamentous structure with SEPTIN12, SEPTIN6, SEPTIN2 and probably SEPTIN4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, spindle. Chromosome, centromere, kinetochore. Cleavage furrow. Midbody. Cell projection, cilium, flagellum.
Target Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family
Target Tissue Specificity
Widely expressed.
Target Synonyms
KIAA0128; Nkrf; RCG53214; isoform CRA_d; RP5-876A24.2; SEP2 ; SEPT2; SEPT6; SEPT6/MLL FUSION GENE; SEPT6_HUMAN; Septin 2 ; Septin 6; Septin-6
Target Background
This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined.
Notification