Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC17A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A1 (NP_005065.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC17A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A1 (NP_005065.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08573A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC17A1 |
| Target Synonyms | NPT1; NPT-1; NAPI-1; SLC17A1 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A1 (NP_005065.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGY | Uniprot ID | Q14916 |
Uniprot Id
Q14916
Target Species
Human
Target Name
SLC17A1
Target Full Name
Sodium-dependent phosphate transport protein 1
Target Function
Important for the resorption of phosphate by the kidney. May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Plays a role in urate transport in the kidney.
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Sodium/anion cotransporter family
Target Tissue Specificity
Expressed in kidney cortex, liver and brain but not in other tissues.
Target Synonyms
Na(+)/PI cotransporter 1; Na/Pi-4; NAP 1; Napi1; NPT 1; Npt1; NPT1_HUMAN; Renal Na(+)-dependent phosphate cotransporter 1; Renal sodium-dependent phosphate transport protein 1; Renal sodium-phosphate transport protein 1; Slc17a1; Sodium phosphate transporter; Sodium-dependent phosphate transport protein 1; Sodium/phosphate cotransporter 1; Sodium/phosphate type I cotransporter; Solute carrier family 17 (organic anion transporter) member 1; solute carrier family 17 (sodium phosphate), member 1; Solute carrier family 17 (vesicular glutamate transporter) member 1; Solute carrier family 17 member 1
Target Background
Predicted to enable sialic acid transmembrane transporter activity. Involved in urate metabolic process and urate transport. Located in apical plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
