Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC27A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 506-600 of human SLC27A6 (NP_054750.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against SLC27A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 506-600 of human SLC27A6 (NP_054750.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded human liver using SLC27A6 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-08225A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC27A6 |
| Target Synonyms | SLC27A6; ACSVL2; FACVL2; FATP6; VLCS-H1; solute carrier family 27 member 6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 506-600 of human SLC27A6 (NP_054750.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKS | Uniprot ID | Q9Y2P4 |
Uniprot Id
Q9Y2P4
Target Species
Human
Target Name
SLC27A6
Target Full Name
Long-chain fatty acid transport protein 6
Target Function
Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Thought to function as the predominant fatty acid protein transporter in heart. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids (VLCFAs).
Target Subcellular Location
Cell membrane, sarcolemma; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
ATP-dependent AMP-binding enzyme family
Target Tissue Specificity
Strongly expressed in heart and localizes to cardiac myocytes. Expressed at moderate levels in placenta, testis, and adrenal glands. Expressed at very low levels in kidney, bladder and uterus.
Target Synonyms
SLC27A6; ACSVL2; FACVL2; FATP6; Long-chain fatty acid transport protein 6; FATP-6; Fatty acid transport protein 6; Arachidonate--CoA ligase; Fatty-acid-coenzyme A ligase, very long-chain 2; Solute carrier family 27 member 6; Very long-chain acyl-CoA synthetase homolog 1; VLCSH1; hVLCS-H1
Target Background
This gene encodes a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
