-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBK1/NAK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human TBK1/NAK (NP_037386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TBK1/NAK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human TBK1/NAK (NP_037386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12868A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBK1/NAK |
| Target Synonyms | NAK; T2K; IIAE8; FTDALS4; TBK1/NAK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Mouse lung, Rat thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human TBK1/NAK (NP_037386.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH | Uniprot ID | Q9UHD2 |
Uniprot Id
Q9UHD2
Target Species
Human
Target Name
TBK1
Target Full Name
Serine/threonine-protein kinase TBK1
Target Function
Serine/threonine kinase that plays an essential role in regulating inflammatory responses to foreign agents. Following activation of toll-like receptors by viral or bacterial components, associates with TRAF3 and TANK and phosphorylates interferon regulatory factors (IRFs) IRF3 and IRF7 as well as DDX3X. This activity allows subsequent homodimerization and nuclear translocation of the IRFs leading to transcriptional activation of pro-inflammatory and antiviral genes including IFNA and IFNB. In order to establish such an antiviral state, TBK1 form several different complexes whose composition depends on the type of cell and cellular stimuli. Plays a key role in IRF3 activation: acts by first phosphorylating innate adapter proteins MAVS, STING1 and TICAM1 on their pLxIS motif, leading to recruitment of IRF3, thereby licensing IRF3 for phosphorylation by TBK1. Phosphorylated IRF3 dissociates from the adapter proteins, dimerizes, and then enters the nucleus to induce expression of interferons. Thus, several scaffolding molecules including FADD, TRADD, MAVS, AZI2, TANK or TBKBP1/SINTBAD can be recruited to the TBK1-containing-complexes. Under particular conditions, functions as a NF-kappa-B effector by phosphorylating NF-kappa-B inhibitor alpha/NFKBIA, IKBKB or RELA to translocate NF-Kappa-B to the nucleus. Restricts bacterial proliferation by phosphorylating the autophagy receptor OPTN/Optineurin on 'Ser-177', thus enhancing LC3 binding affinity and antibacterial autophagy. Phosphorylates SMCR8 component of the C9orf72-SMCR8 complex, promoting autophagosome maturation. Phosphorylates and activates AKT1. Seems to play a role in energy balance regulation by sustaining a state of chronic, low-grade inflammation in obesity, wich leads to a negative impact on insulin sensitivity. Attenuates retroviral budding by phosphorylating the endosomal sorting complex required for transport-I (ESCRT-I) subunit VPS37C. Phosphorylates Borna disease virus (BDV) P protein. Plays an essential role in the TLR3- and IFN-dependent control of herpes virus HSV-1 and HSV-2 infections in the central nervous system.
Target Involvement
Glaucoma 1, open angle, P (GLC1P); Frontotemporal dementia and/or amyotrophic lateral sclerosis 4 (FTDALS4)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, I-kappa-B kinase subfamily
Target Tissue Specificity
Ubiquitous with higher expression in testis. Expressed in the ganglion cells, nerve fiber layer and microvasculature of the retina.
Target Research Area
Cancer
Target Synonyms
EC 2.7.11.1; FLJ11330; FTDALS4; NAK; NF kappa B activating kinase; NF kB activating kinase; NF-kappa-B-activating kinase; Serine/threonine protein kinase TBK 1; Serine/threonine protein kinase TBK1; Serine/threonine-protein kinase TBK1; T2K; TANK binding kinase 1; TANK-binding kinase 1; TBK 1; Tbk1; TBK1_HUMAN
Target Background
The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. The protein is also an important kinase for antiviral innate immunity response.
Notification