-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCEB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human TCEB1 (NP_001191791.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TCEB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human TCEB1 (NP_001191791.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00536A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCEB1 |
| Target Synonyms | SIII; TCEB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Jurkat, Mouse brain, Mouse testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human TCEB1 (NP_001191791.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC | Uniprot ID | Q15369 |
Uniprot Id
Q15369
Target Species
Human
Target Name
ELOC
Target Full Name
Elongin-C
Target Function
SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells.; Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins. This includes the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes. A number of ECS complexes (containing either KLHDC2, KLHDC3, KLHDC10, APPBP2, FEM1A, FEM1B or FEM1C as substrate-recognition component) are part of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation.
Target Subcellular Location
Nucleus.
Target Protein Families
SKP1 family
Target Tissue Specificity
Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.
Target Research Area
Immunology
Target Synonyms
Elo C; EloC; ELOC_HUMAN; Elongin 15 kDa subunit; Elongin C; Elongin-C; ElonginC; RNA polymerase II transcription factor SIII subunit C; SIII; SIII p15; TCEB 1; tceb1; Transcription elongation factor B (SIII) polypeptide 1; Transcription elongation factor B polypeptide 1
Target Background
This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.
Notification