Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM119 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-270 of human TMEM119 (NP_859075.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM119 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-270 of human TMEM119 (NP_859075.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using TMEM119 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 120s.
| Cat.No | ADA-07972A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM119 |
| Target Synonyms | OBIF; TMEM119 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-270 of human TMEM119 (NP_859075.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPP | Uniprot ID | Q4V9L6 |
Uniprot Id
Q4V9L6
Target Species
Human
Target Name
TMEM119
Target Full Name
Transmembrane protein 119
Target Function
Plays an important role in bone formation and normal bone mineralization. Promotes the differentiation of myoblasts into osteoblasts. May induce the commitment and differentiation of myoblasts into osteoblasts through an enhancement of BMP2 production and interaction with the BMP-RUNX2 pathway. Upregulates the expression of ATF4, a transcription factor which plays a central role in osteoblast differentiation. Essential for normal spermatogenesis and late testicular differentiation.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm. Endoplasmic reticulum membrane.
Target Tissue Specificity
Expressed in brain microglia (at protein level). Elevated expression levels seen in the brain of patients with Alzheimer disease. Expressed by osteoblast-like cells in bone tissues and follicular dendritic cells in lymphoid tissues.
Target Research Area
Others
Target Synonyms
TMEM119; PSEC0199; UNQ731/PRO1415; Transmembrane protein 119; Osteoblast induction factor; OBIF
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
