-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TRIM27 (NP_006501.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against TRIM27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TRIM27 (NP_006501.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-00564A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM27 |
| Target Synonyms | RFP; RNF76; TRIM27 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Raji, SH-SY5Y | Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TRIM27 (NP_006501.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRL | Uniprot ID | P14373 |
Uniprot Id
P14373
Target Species
Human
Target Name
TRIM27
Target Full Name
Zinc finger protein RFP
Target Function
E3 ubiquitin-protein ligase that mediates ubiquitination of PIK3C2B and inhibits its activity; mediates the formation of 'Lys-48'-linked polyubiquitin chains; the function inhibits CD4 T-cell activation. Acts as a regulator of retrograde transport: together with MAGEL2, mediates the formation of 'Lys-63'-linked polyubiquitin chains at 'Lys-220' of WASHC1, leading to promote endosomal F-actin assembly. Has a transcriptional repressor activity by cooperating with EPC1. Induces apoptosis by activating Jun N-terminal kinase and p38 kinase and also increases caspase-3-like activity independently of mitochondrial events. May function in male germ cell development. Has DNA-binding activity and preferentially bound to double-stranded DNA.
Target Involvement
A chromosomal aberration involving TRIM27/RFP is found in papillary thyroid carcinomas (PTCs). Translocation t(6;10)(p21.3;q11.2) with RET. The translocation generates TRIM27/RET and delta TRIM27/RET oncogenes.
Target Subcellular Location
Nucleus. Cytoplasm. Nucleus, PML body. Early endosome.
Target Protein Families
TRIM/RBCC family
Target Tissue Specificity
Expressed in testis namely within the seminiferous tubules.
Target Synonyms
AW538890; DAAP-182E11.3; MGC189472; OTTHUMP00000029314; Ret finger protein; RFP; RFP transforming protein; Rfp1; RING finger protein 76; RNF76; TRI27_HUMAN; TRIM 27; Trim27; Tripartite motif containing 27; Tripartite motif containing protein 27; Tripartite motif protein TRIM27; Tripartite motif-containing protein 27; Zinc finger protein RFP
Target Background
This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nuclear matrix. It interacts with the enhancer of polycomb protein and represses gene transcription. It is also thought to be involved in the differentiation of male germ cells. Fusion of the N-terminus of this protein with the truncated C-terminus of the RET gene product has been shown to result in production of the ret transforming protein.
Notification