Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UCN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-112 of human UCN2 (NP_149976.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UCN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-112 of human UCN2 (NP_149976.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02996A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UCN2 |
| Target Synonyms | UR; SRP; URP; UCNI; UCN-II; UCN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat skin | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-112 of human UCN2 (NP_149976.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC | Uniprot ID | Q96RP3 |
Uniprot Id
Q96RP3
Target Species
Human
Target Name
UCN2
Target Full Name
Urocortin-2
Target Function
Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
Target Subcellular Location
Secreted.
Target Protein Families
Sauvagine/corticotropin-releasing factor/urotensin I family
Target Research Area
Cardiovascular
Target Synonyms
SRP; Stresscopin related peptide; Stresscopin-related peptide; Ucn II; Ucn2; UCN2_HUMAN; UCNI; UCNII; UR; Urocortin II; Urocortin related peptide; Urocortin-2; Urocortin-related peptide; URP
Target Background
This gene is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it may be responsible for the effects of stress on appetite. In spite of the gene family name similarity, the product of this gene has no sequence similarity to urotensin II.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
