Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UNC50 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UNC50 (NP_054763.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UNC50 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UNC50 (NP_054763.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04632A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UNC50 |
| Target Synonyms | URP; GMH1; UNCL; HSD23; PDLs22; UNC50 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549, MCF7, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UNC50 (NP_054763.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFG | Uniprot ID | Q53HI1 |
Uniprot Id
Q53HI1
Target Species
Human
Target Name
UNC50
Target Full Name
Protein unc-50 homolog
Target Function
Involved in the cell surface expression of neuronal nicotinic receptors. Binds RNA.
Target Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
Unc-50 family
Target Tissue Specificity
Present in periodontal ligament fibroblasts (at protein level).
Target Synonyms
UNC50; UNCL; HSD-23; HSD23; Protein unc-50 homolog; Periodontal ligament-specific protein 22; PDLs22; Protein GMH1 homolog; hGMH1; Uncoordinated-like protein
Target Background
Predicted to enable RNA binding activity. Predicted to be involved in protein localization to cell surface. Predicted to be located in Golgi apparatus and nuclear inner membrane. Predicted to be integral component of Golgi membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
