-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UXT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 13-169 of human UXT (NP_705582.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UXT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 13-169 of human UXT (NP_705582.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03990A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UXT |
| Target Synonyms | SKP2; STAP1; ART-27; UXT | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HL-60 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 13-169 of human UXT (NP_705582.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH | Uniprot ID | Q9UBK9 |
Uniprot Id
Q9UBK9
Target Species
Human
Target Name
UXT
Target Full Name
Protein UXT
Target Function
Involved in gene transcription regulation. Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription. Together with URI1, associates with chromatin to the NKX3-1 promoter region. Negatively regulates the transcriptional activity of the estrogen receptor ESR1 by inducing its translocation into the cytoplasm. May act as nuclear chaperone that facilitates the formation of the NF-kappa-B enhanceosome and thus positively regulates NF-kappa-B transcription activity. Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling. Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM.; Plays a role in protecting cells against TNF-alpha-induced apoptosis by preventing the recruitment of FADD and caspase 8 to the apoptotic complex I, composed of TRADD, TRAF2 and RIPK1/RIP.
Target Subcellular Location
[Isoform 1]: Cytoplasm.; Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole.
Target Protein Families
UXT family
Target Tissue Specificity
Ubiquitous. Expressed in prostate epithelial cells. Expressed in mammary epithelial cells. Highest levels in the heart, skeletal muscle, pancreas, kidney, liver, adrenal gland, peripheral blood leukocytes, lymph node, prostate, and thyroid and the lowest
Target Synonyms
Androgen receptor trapped clone 27 protein; ART 27 ; ART-27; OTTHUMP00000023226; OTTHUMP00000023227; Protein UXT; SKP2 associated alpha PFD 1; STAP1; Ubiquitously expressed prefoldin like chaperone; Ubiquitously expressed transcript; Ubiquitously expressed transcript protein; Uxt; UXT_HUMAN
Target Background
The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification