Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VASN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-575 of human VASN (NP_612449.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VASN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-575 of human VASN (NP_612449.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11344A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VASN |
| Target Synonyms | SLITL2; VASN | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse lung, Mouse testis, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 420-575 of human VASN (NP_612449.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CHLGTRHHLACLCPEGFTGLYCESQMGQGTRPSPTPVTPRPPRSLTLGIEPVSPTSLRVGLQRYLQGSSVQLRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLRPNATYSVCVMPLGPGRVPEGEEACGEAHTPPAVHSNHAPVTQAREGNLP | Uniprot ID | Q6EMK4 |
Uniprot Id
Q6EMK4
Target Species
Human
Target Name
VASN
Target Full Name
Vasorin
Target Function
May act as an inhibitor of TGF-beta signaling.
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Secreted.
Target Tissue Specificity
Expressed at highest levels in aorta, at intermediate levels in kidney and placenta and at lowest levels in brain, heart, liver, lung and skeletal muscle. Within the aorta, the strongest expression is found in the tunica media of the proximal ascending ao
Target Synonyms
2610528G05Rik; PRO1282; PRO357; Protein slit-like 2; Slit like 2; Slitl2; UNQ314; Vasn; VASN_HUMAN; Vasorin
Target Background
Enables transforming growth factor beta binding activity. Involved in negative regulation of epithelial to mesenchymal transition and negative regulation of transforming growth factor beta receptor signaling pathway. Located in cell surface and extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
