Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD168 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 716-794 of mouse CD168 (NP_038580.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against CD168 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 716-794 of mouse CD168 (NP_038580.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of HepG2 cells using CD168 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Cat.No | ADA-08211A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD168 |
| Target Synonyms | HMMR; CD168; IHABP; RHAMM; hyaluronan mediated motility receptor | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 716-794 of mouse CD168 (NP_038580.2). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | QNLKQKIKHVVKLKDENSQLKSEVSKLRSQLVKRKQNELRLQGELDKALGIRHFDPSKAFCHASKENFTPLKEGNPNCC | Uniprot ID | Q00547 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
