-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Alpha-1 Antitrypsin (SERPINA1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 156-255 of human Alpha-1 Antitrypsin (SERPINA1) (NP_000286.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Alpha-1 Antitrypsin (SERPINA1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 156-255 of human Alpha-1 Antitrypsin (SERPINA1) (NP_000286.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12201A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Alpha-1 Antitrypsin (SERPINA1) |
| Target Synonyms | PI; A1A; AAT; PI1; A1AT; nNIF; PRO2275; alpha1AT; Alpha-1 Antitrypsin (SERPINA1) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 156-255 of human Alpha-1 Antitrypsin (SERPINA1) (NP_000286.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH | Uniprot ID | P01009 |
Uniprot Id
P01009
Target Species
Human
Target Name
SERPINA1
Target Full Name
Alpha-1-antitrypsin
Target Function
Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.; reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).
Target Involvement
Alpha-1-antitrypsin deficiency (A1ATD)
Target Subcellular Location
Secreted. Endoplasmic reticulum. Note=The S and Z allele are not secreted effectively and accumulate intracellularly in the endoplasmic reticulum.; [Short peptide from AAT]: Secreted, extracellular space, extracellular matrix.
Target Protein Families
Serpin family
Target Tissue Specificity
Ubiquitous. Expressed in leukocytes and plasma.
Target Research Area
Immunology
Target Synonyms
A1A; A1AT; A1AT_HUMAN; AAT; Alpha 1 antiproteinase; Alpha 1 antitrypsin; Alpha 1 antitrypsin null; Alpha 1 protease inhibitor; Alpha-1 protease inhibitor; Alpha-1-antiproteinase; alpha1 proteinase inhibitor; Alpha1AT; Dom1; PI; PI1; PRO0684; PRO2275; Serine (or cysteine) proteinase inhibitor clade A member 1; Serine protease inhibitor 1-1; Serine protease inhibitor A1a; Serpin A1; Serpin A1a; Serpin peptidase inhibitor clade A member 1; Serpina1; Short peptide from AAT; SPAAT; Spi1-1
Target Background
The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene.
Notification