-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Calnexin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-592 of human Calnexin (NP_001737.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Calnexin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-592 of human Calnexin (NP_001737.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13030A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Calnexin |
| Target Synonyms | CNX; P90; IP90; Calnexin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HepG2, Jurkat, MCF7, Mouse brain, Mouse liver, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-592 of human Calnexin (NP_001737.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE | Uniprot ID | P27824 |
Uniprot Id
P27824
Target Species
Human
Target Name
CANX
Target Full Name
Calnexin
Target Function
Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins. Associated with partial T-cell antigen receptor complexes that escape the ER of immature thymocytes, it may function as a signaling complex regulating thymocyte maturation. Additionally it may play a role in receptor-mediated endocytosis at the synapse.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Endoplasmic reticulum. Melanosome.
Target Protein Families
Calreticulin family
Target Synonyms
CANX; Calnexin; IP90; Major histocompatibility complex class I antigen-binding protein p88; p90
Target Background
This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification