-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYT11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SYT11 (NP_689493.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SYT11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SYT11 (NP_689493.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00022A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYT11 |
| Target Synonyms | SYT12; sytXI; SYT11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SYT11 (NP_689493.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WSCCHQQAEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKM | Uniprot ID | Q9BT88 |
Uniprot Id
Q9BT88
Target Species
Human
Target Name
SYT11
Target Full Name
Synaptotagmin-11
Target Function
Synaptotagmin family member involved in vesicular and membrane trafficking which does not bind Ca(2+). Inhibits clathrin-mediated and bulk endocytosis, functions to ensure precision in vesicle retrieval. Plays an important role in dopamine transmission by regulating endocytosis and the vesicle-recycling process. Essential component of a neuronal vesicular trafficking pathway that differs from the synaptic vesicle trafficking pathway but is crucial for development and synaptic plasticity. In macrophages and microglia, inhibits the conventional cytokine secretion, of at least IL6 and TNF, and phagocytosis. In astrocytes, regulates lysosome exocytosis, mechanism required for the repair of injured astrocyte cell membrane. Required for the ATP13A2-mediated regulation of the autophagy-lysosome pathway.
Target Subcellular Location
Cytoplasmic vesicle membrane; Single-pass membrane protein. Perikaryon. Golgi apparatus, trans-Golgi network membrane; Single-pass membrane protein. Recycling endosome membrane; Single-pass membrane protein. Lysosome membrane; Single-pass membrane protein. Cytoplasmic vesicle, phagosome. Cell projection, axon. Cell projection, dendrite. Cell junction, synapse, postsynaptic density. Recycling endosome membrane; Single-pass membrane protein. Cytoplasmic vesicle, clathrin-coated vesicle membrane; Single-pass membrane protein. Perikaryon.
Target Protein Families
Synaptotagmin family
Target Synonyms
DKFZp781D015; KIAA0080; MGC10881; MGC17226; Synaptotagmin 11; Synaptotagmin 12; Synaptotagmin XI; Synaptotagmin-11; Synaptotagmin11; Synaptotagmin12; SynaptotagminXI; SYT 11; SYT 12; Syt XI; Syt11; SYT11_HUMAN; SYT12; SytXI
Target Background
This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that are known calcium sensors and mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. The encoded protein is also a substrate for ubiquitin-E3-ligase parkin. The gene has previously been referred to as synaptotagmin XII but has been renamed synaptotagmin XI to be consistent with mouse and rat official nomenclature.
Notification