Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTPN5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-307 of human PTPN5 (NP_116170.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PTPN5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-307 of human PTPN5 (NP_116170.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00190A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTPN5 |
| Target Synonyms | STEP; STEP61; PTPSTEP; PTPN5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 190-307 of human PTPN5 (NP_116170.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEI | Uniprot ID | P54829 |
Uniprot Id
P54829
Target Species
Human
Target Name
PTPN5
Target Full Name
Tyrosine-protein phosphatase non-receptor type 5
Target Function
May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class subfamily
Target Synonyms
FLJ14427; Neural specific protein tyrosine phosphatase; Neural-specific protein-tyrosine phosphatase; Protein tyrosine phosphatase non receptor type 5 (striatum enriched); Protein tyrosine phosphatase non receptor type 5; Protein tyrosine phosphatase striatum enriched; PTN5; PTN5_HUMAN; PTP STEP; PTPN 5; Ptpn5; PTPSTEP; STEP; Striatum-enriched protein-tyrosine phosphatase; Tyrosine protein phosphatase non receptor type 5; Tyrosine-protein phosphatase non-receptor type 5
Target Background
Enables phosphotyrosine residue binding activity. Predicted to be involved in peptidyl-tyrosine dephosphorylation. Predicted to act upstream of or within protein dephosphorylation. Predicted to be located in nucleoplasm. Predicted to be integral component of membrane. Biomarker of Alzheimer's disease.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
