-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EFS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human EFS (NP_115835.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EFS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human EFS (NP_115835.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00251A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EFS |
| Target Synonyms | SIN; CAS3; EFS1; EFS2; HEFS; CASS3; EFS | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human EFS (NP_115835.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TALRVPSSGPYDCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGREPGPPIYAAPSNLKRASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALASHDQDTLAQL | Uniprot ID | O43281 |
Uniprot Id
O43281
Target Species
Human
Target Name
EFS
Target Full Name
Embryonal Fyn-associated substrate
Target Function
Docking protein which plays a central coordinating role for tyrosine-kinase-based signaling related to cell adhesion. May serve as an activator of SRC and a downstream effector. Interacts with the SH3 domain of FYN and with CRK, SRC, and YES.
Target Protein Families
CAS family
Target Tissue Specificity
The protein has been detected in lung and placenta.
Target Synonyms
EFS; CASS3Embryonal Fyn-associated substrate; hEFS; Cas scaffolding protein family member 3
Target Background
The protein encoded by this gene is a member of the CAS (CRK-associated substrate) family of adaptor proteins which typically serve as scaffolds for the assembly of larger signaling complexes. These complexes form at the cell surface where integrin binding leads to the subsequent phosphorylation of a CAS protein. Additional binding of SRC family kinases leads to CAS hyperphosphorylation and the creation of binding sites for CRK and other proteins that cause actin cytoskeleton reorganization. This gene plays a role in integrin-mediated cell attachment, spreading, and migration and also plays a role in both normal and malignant cellular transformation. This broadly expressed gene has been shown to play a role in neurite outgrowth and its expression in the thymus and lymphocytes is important for T cell maturation and the development of immunological self-tolerance. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
Notification