Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human BRAP (NP_006759.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BRAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human BRAP (NP_006759.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00272A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BRAP |
| Target Synonyms | IMP; BRAP2; RNF52; BRAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, MCF7, Mouse brain, Rat testis, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human BRAP (NP_006759.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPN | Uniprot ID | Q7Z569 |
Uniprot Id
Q7Z569
Target Species
Human
Target Name
BRAP
Target Full Name
BRCA1-associated protein
Target Function
Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a cytoplasmic retention protein with a role in regulating nuclear transport.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Expressed in breast epithelial cell lines.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
BRAP; RNF52BRCA1-associated protein; EC 2.3.2.27; BRAP2; Impedes mitogenic signal propagation; IMP; RING finger protein 52; RING-type E3 ubiquitin transferase BRAP2; Renal carcinoma antigen NY-REN-63
Target Background
The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
