-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APLP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 470-580 of human APLP1 (NP_005157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against APLP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 470-580 of human APLP1 (NP_005157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00509A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APLP1 |
| Target Synonyms | APLP; APLP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 470-580 of human APLP1 (NP_005157.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSRE | Uniprot ID | P51693 |
Uniprot Id
P51693
Target Species
Human
Target Name
APLP1
Target Full Name
Amyloid beta precursor like protein 1
Target Function
May play a role in postsynaptic function. The C-terminal gamma-secretase processed fragment, ALID1, activates transcription activation through APBB1 (Fe65) binding. Couples to JIP signal transduction through C-terminal binding. May interact with cellular G-protein signaling pathways. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I.; The gamma-CTF peptide, C30, is a potent enhancer of neuronal apoptosis.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [C30]: Cytoplasm. Note=C-terminally processed in the Golgi complex.
Target Protein Families
APP family
Target Tissue Specificity
Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD).
Target Synonyms
APLP1; Amyloid beta precursor like protein 1; Amyloid beta; A4 precursor-like protein 1; Amyloid-like protein 1; APLP; APLP-1
Target Background
This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification