Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human TMC1 (NP_619636.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TMC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human TMC1 (NP_619636.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01155A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMC1 |
| Target Synonyms | DFNB7; DFNA36; DFNB11; TMC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human TMC1 (NP_619636.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | INILRLHTSMYFQCWAVMCCNVPEARVFKASRSNNFYLGMLLLILFLSTMPVLYMIVSLPPSFDCGPFSGKNRMFEVIGETLEHDFPSWMAKILRQLSNPG | Uniprot ID | Q8TDI8 |
Uniprot Id
Q8TDI8
Target Species
Human
Target Name
TMC1
Target Full Name
Transmembrane channel-like protein 1
Target Function
Probable ion channel required for the normal function of cochlear hair cells.
Target Involvement
Deafness, autosomal dominant, 36 (DFNA36); Deafness, autosomal recessive, 7 (DFNB7)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
TMC family
Target Tissue Specificity
Detected in fetal cochlea, and at low levels in placenta and testis.
Target Synonyms
TMC1; Transmembrane channel-like protein 1; Transmembrane cochlear-expressed protein 1
Target Background
This gene is considered a member of a gene family predicted to encode transmembrane proteins. The specific function of this gene is unknown; however, it is known to be required for normal function of cochlear hair cells. Mutations in this gene have been associated with progressive postlingual hearing loss and profound prelingual deafness.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
