Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXB9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human HOXB9 (NP_076922.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXB9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human HOXB9 (NP_076922.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01342A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXB9 |
| Target Synonyms | HOX2; HOX2E; HOX-2.5; HOXB9 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human HOXB9 (NP_076922.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHP | Uniprot ID | P17482 |
Uniprot Id
P17482
Target Species
Human
Target Name
HOXB9
Target Full Name
Homeobox protein Hox-B9
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Subcellular Location
Nucleus.
Target Protein Families
Abd-B homeobox family
Target Synonyms
Homeo box 2E ; Homeo box B9 ; Homeobox B9; Homeobox protein Hox B9; Homeobox protein Hox-2.5; Homeobox protein Hox-2E; Homeobox protein Hox-B9; Hox 2.5; Hox 2E; HOX2; HOX2E; Hoxb9; HXB9_HUMAN; OTTHUMP00000216946; OTTHUMP00000243325
Target Background
This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
