-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P Glycoprotein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-710 of human P Glycoprotein (NP_000918.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against P Glycoprotein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-710 of human P Glycoprotein (NP_000918.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03276A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P Glycoprotein |
| Target Synonyms | CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170; p-170; P Glycoprotein | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 630-710 of human P Glycoprotein (NP_000918.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY | Uniprot ID | P08183 |
Uniprot Id
P08183
Target Species
Human
Target Name
ABCB1
Target Full Name
ATP-dependent translocase ABCB1
Target Function
Translocates drugs and phospholipids across the membrane. Catalyzes the flop of phospholipids from the cytoplasmic to the exoplasmic leaflet of the apical membrane. Participates mainly to the flop of phosphatidylcholine, phosphatidylethanolamine, beta-D-glucosylceramides and sphingomyelins. Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Target Involvement
Inflammatory bowel disease 13 (IBD13)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane.
Target Protein Families
ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
Target Tissue Specificity
Expressed in liver, kidney, small intestine and brain.
Target Research Area
Transport
Target Synonyms
ABC20; ABCB1; ATP binding cassette, sub family B (MDR/TAP), member 1; ATP-binding cassette sub-family B member 1; CD243; CLCS; Colchicin sensitivity; Doxorubicin resistance; GP170; MDR1; MDR1_HUMAN; Multidrug resistance 1; Multidrug resistance protein 1; P glycoprotein 1; P gp; P-glycoprotein 1; PGY1
Target Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. Mutations in this gene are associated with colchicine resistance and Inflammatory bowel disease 13. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Notification