Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IFNL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFNL3 (NP_742151.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IFNL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFNL3 (NP_742151.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03725A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IFNL3 |
| Target Synonyms | IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4; IFNL3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse thymus, Recombinant Human IFNL3 Protein | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFNL3 (NP_742151.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELAL | Uniprot ID | Q8IZI9 |
Uniprot Id
Q8IZI9
Target Species
Human
Target Name
IFNL3
Target Full Name
Interferon lambda-3
Target Function
Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression.
Target Subcellular Location
Secreted.
Target Protein Families
Lambda interferon family
Target Synonyms
Cytokine ZCYTO22; IFN-lambda-3; IFN-lambda-4; IL-28B; IL-28C; IL28B; IL28B_HUMAN; IL28C; Interferon lambda-3; Interferon lambda-4; interleukin 28B (interferon; lambda 3); Interleukin 28C; Interleukin-28B; Interleukin-28C
Target Background
This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
