-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSCA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 12-114 of human PSCA (NP_005663.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PSCA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 12-114 of human PSCA (NP_005663.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03740A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSCA |
| Target Synonyms | PRO232; lncPSCA; PSCA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 12-114 of human PSCA (NP_005663.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL | Uniprot ID | O43653 |
Uniprot Id
O43653
Target Species
Human
Target Name
PSCA
Target Full Name
Prostate stem cell antigen
Target Function
May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.; May act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits nicotine-induced signaling probably implicating alpha-3:beta-2- or alpha-7-containing nAChRs.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Tissue Specificity
Highly expressed in prostate (basal, secretory and neuroendocrine epithelium cells). Also found in bladder (transitional epithelium), placenta (trophoblasts), stomach (neuroendocrine cells), colon (neuroendocrine cells) and kidney (collecting ducts). Over
Target Research Area
Cancer, Tags & Cell Markers
Target Synonyms
PSCA; UNQ206/PRO232; Prostate stem cell antigen
Target Background
This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
Notification