Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC39A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-320 of human SLC39A6 (NP_001092876.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC39A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-320 of human SLC39A6 (NP_001092876.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03924A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC39A6 |
| Target Synonyms | LIV1; ZIP6; LIV-1; SLC39A6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, BT-474, MCF7, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-320 of human SLC39A6 (NP_001092876.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGVATL | Uniprot ID | Q13433 |
Uniprot Id
Q13433
Target Species
Human
Target Name
SLC39A6
Target Full Name
Zinc transporter ZIP6
Target Function
May act as a zinc-influx transporter.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
ZIP transporter (TC 2.A.5) family
Target Tissue Specificity
Highly expressed in the breast, prostate, placenta, kidney, pituitary and corpus callosum. Weakly expressed in heart and intestine. Also highly expressed in cells derived from an adenocarcinoma of the cervix and lung carcinoma.
Target Synonyms
SLC39A6; LIV1; ZIP6; Zinc transporter ZIP6; Estrogen-regulated protein LIV-1; Solute carrier family 39 member 6; Zrt- and Irt-like protein 6; ZIP-6
Target Background
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
