Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EXTL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 52-220 of human EXTL3 (NP_001431.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EXTL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 52-220 of human EXTL3 (NP_001431.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04045A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EXTL3 |
| Target Synonyms | RPR; BOTV; REGR; EXTR1; ISDNA; EXTL1L; EXTL3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse pancreas, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 52-220 of human EXTL3 (NP_001431.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TTLDEADEAGKRIFGPRVGNELCEVKHVLDLCRIRESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQNQPKLSLPIRLLPEKDDAGLPPPKATRGCRLHNCFDYSRCPLTSGFPVYVYDSDQFVFGSYLDPLVKQAFQA | Uniprot ID | O43909 |
Uniprot Id
O43909
Target Species
Human
Target Name
EXTL3
Target Full Name
Exostosin-like 3
Target Function
Glycosyltransferase which regulates the biosynthesis of heparan sulfate (HS). Important for both skeletal development and hematopoiesis, through the formation of HS proteoglycans (HSPGs). Required for the function of REG3A in regulating keratinocyte proliferation and differentiation.
Target Involvement
Immunoskeletal dysplasia with neurodevelopmental abnormalities (ISDNA)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein. Golgi apparatus.
Target Protein Families
Glycosyltransferase 47 family
Target Tissue Specificity
Ubiquitous. Expressed in keratinocytes.
Target Research Area
Others
Target Synonyms
botv; DKFZp686C2342; Exostoses (multiple)-like 3; Exostoses-like 3; Exostosin-like 3; EXT-related protein 1; EXTL1L; EXTL3; EXTL3_HUMAN; EXTR1; Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferas; Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; Hereditary multiple exostoses gene isolog; KIAA0519; Multiple exostosis-like protein 3; Putative tumor suppressor protein EXTL3; REG; Reg receptor; REGR; RPR
Target Background
This gene encodes a single-pass membrane protein which functions as a glycosyltransferase. The encoded protein catalyzes the transfer of N-acetylglucosamine to glycosaminoglycan chains. This reaction is important in heparin and heparan sulfate synthesis. Alternative splicing results in the multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
