Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC1A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 155-265 of human SLC1A6 (NP_001259016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC1A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 155-265 of human SLC1A6 (NP_001259016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04241A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC1A6 |
| Target Synonyms | EAAT4; SLC1A6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, HepG2, Mouse liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 155-265 of human SLC1A6 (NP_001259016.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANG | Uniprot ID | P48664 |
Uniprot Id
P48664
Target Species
Human
Target Name
SLC1A6
Target Full Name
Excitatory amino acid transporter 4
Target Function
Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion. Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport. Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A6 subfamily
Target Tissue Specificity
Brain. Expressed densely and selectively in cell bodies of Purkinje cells.
Target Research Area
Neuroscience
Target Synonyms
SLC1A6; EAAT4Excitatory amino acid transporter 4; Sodium-dependent glutamate/aspartate transporter; Solute carrier family 1 member 6
Target Background
Predicted to enable high-affinity glutamate transmembrane transporter activity. Involved in neurotransmitter uptake. Located in intermediate filament cytoskeleton and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
