-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MS4A7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A7 (NP_067024.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MS4A7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A7 (NP_067024.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05015A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MS4A7 |
| Target Synonyms | CFFM4; MS4A8; 4SPAN2; CD20L4; MS4A7 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A7 (NP_067024.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAA | Uniprot ID | Q9GZW8 |
Uniprot Id
Q9GZW8
Target Species
Human
Target Name
MS4A7
Target Full Name
Membrane-spanning 4-domains subfamily A member 7
Target Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
MS4A family
Target Tissue Specificity
Ubiquitous expression in normal tissues. Expression is more elevated in adult liver, lung, spleen, and heart than in their fetal counterparts, and is higher in normal tissues than in the cancerous tissue or cell lines. Low levels of expression were detect
Target Synonyms
MS4A7; 4SPAN2; CD20L4; CFFM4; Membrane-spanning 4-domains subfamily A member 7; CD20 antigen-like 4; CD20/FC-epsilon-RI-beta family member 4; Four-span transmembrane protein 2
Target Background
This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed.
Notification