Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCTA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TCTA (NP_071503.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TCTA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TCTA (NP_071503.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05139A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCTA |
| Target Synonyms | TCTA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7, SGC-7901 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TCTA (NP_071503.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE | Uniprot ID | P57738 |
Uniprot Id
P57738
Target Species
Human
Target Name
TCTA
Target Full Name
T-cell leukemia translocation-altered gene protein
Target Function
May be required for cellular fusion during osteoclastogenesis.
Target Involvement
A chromosomal aberration involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(1;3)(p34;p21).
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
TCTA family
Target Tissue Specificity
Ubiquitous. Highest level of expression in kidney. Present in monocytes, osteoclasts, macrophages, synoviocytes and synovial lining cells (at protein level).
Target Synonyms
T-cell leukemia translocation altered gene; T-cell leukemia translocation-altered gene protein; T-cell leukemia translocation-associated gene protein; Tcta; TCTA_HUMAN
Target Background
Involved in negative regulation of osteoclast differentiation and osteoclast fusion. Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
