-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB1A (NP_004152.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RAB1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB1A (NP_004152.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05516A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB1A |
| Target Synonyms | RAB1; YPT1; RAB1A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB1A (NP_004152.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFN | Uniprot ID | P62820 |
Uniprot Id
P62820
Target Species
Human
Target Name
RAB1A
Target Full Name
Ras-related protein Rab-1A
Target Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport.
Target Subcellular Location
Golgi apparatus. Endoplasmic reticulum. Early endosome. Cytoplasm, cytosol. Membrane. Melanosome.
Target Protein Families
Small GTPase superfamily, Rab family
Target Synonyms
GTP binding protein RAB 1A; mKIAA3012; RAB 1; Rab 1A; RAB1; RAB1, member RAS oncogene family; Rab1A; RAB1A member RAS oncogene family; RAB1A_HUMAN; Ras related protein Rab 1A; Ras-associated protein RAB1; Ras-related protein Rab-1A; YPT1; YPT1 related protein; YPT1-related protein
Target Background
This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms.
Notification