Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCEE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human MCEE (NP_115990.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MCEE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human MCEE (NP_115990.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05644A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCEE |
| Target Synonyms | MCE; MMCE; GLOD2; MCEE | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, LO2, Mouse brain, Mouse uterus, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human MCEE (NP_115990.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA | Uniprot ID | Q96PE7 |
Uniprot Id
Q96PE7
Target Species
Human
Target Name
MCEE
Target Full Name
Methylmalonyl-CoA epimerase, mitochondrial
Target Function
Methylmalonyl-CoA epimerase involved in propionyl-CoA metabolism.
Target Involvement
Methylmalonyl-CoA epimerase deficiency (MCEED)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Glyoxalase I family
Target Synonyms
DL methylmalonyl CoA racemase; DL-methylmalonyl-CoA racemase; EC 5.1.99.1; GLOD2 ; Glyoxalase domain containing 2 ; MCEE; MCEE_HUMAN; Methylmalonyl CoA epimerase; Methylmalonyl-CoA epimerase; methylmalonyl-CoA epimerase; mitochondrial; mitochondrial; OTTHUMP00000160122
Target Background
The product of this gene catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
