Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P3H4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 338-437 of human P3H4 (NP_006446.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against P3H4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 338-437 of human P3H4 (NP_006446.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10278A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P3H4 |
| Target Synonyms | NO55; SC65; NOL55; LEPREL4; P3H4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 338-437 of human P3H4 (NP_006446.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQEPDAKGDEAEAEPEPELA | Uniprot ID | Q92791 |
Uniprot Id
Q92791
Target Species
Human
Target Name
P3H4
Target Full Name
Endoplasmic reticulum protein SC65
Target Function
Part of a complex composed of PLOD1, P3H3 and P3H4 that catalyzes hydroxylation of lysine residues in collagen alpha chains and is required for normal assembly and cross-linking of collagen fibrils. Required for normal bone density and normal skin stability via its role in hydroxylation of lysine residues in collagen alpha chains and in collagen fibril assembly.
Target Subcellular Location
Endoplasmic reticulum.
Target Protein Families
Leprecan family
Target Tissue Specificity
Detected in fibroblasts (at protein level). Detected in spleen, prostate, testis, ovary, colon, pancreas, kidney, placenta and heart.
Target Synonyms
P3H4; LEPREL4; NOL55; SC65; Endoplasmic reticulum protein SC65; Leprecan-like protein 4; Nucleolar autoantigen No55; Prolyl 3-hydroxylase family member 4; Synaptonemal complex protein SC65
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
