Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC10A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SLC10A1 (NP_003040.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC10A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SLC10A1 (NP_003040.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11135A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC10A1 |
| Target Synonyms | NTCP; FHCA2; SLC10A1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SLC10A1 (NP_003040.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA | Uniprot ID | Q14973 |
Uniprot Id
Q14973
Target Species
Human
Target Name
SLC10A1
Target Full Name
Hepatic sodium/bile acid cotransporter
Target Function
The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.; (Microbial infection) Acts as a receptor for hepatitis B virus.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Bile acid:sodium symporter (BASS) (TC 2.A.28) family
Target Research Area
Cancer
Target Synonyms
Cell growth-inhibiting gene 29 protein; GIG29; Growth inhibiting protein 29; Na / bile acid cotransporter; Na / taurocholate transport protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NTCP; NTCP_HUMAN; NTCP1; SLC10A1; Sodium/bile acid cotransporter; Sodium/taurocholate cotransporter polypeptide, hepatic; Sodium/taurocholate cotransporting polypeptide; Solute carrier family 10 (sodium/bile acid cotransporter family) member 1; Solute carrier family 10 member 1
Target Background
The protein encoded by this gene belongs to the sodium/bile acid cotransporter family, which are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids; the ileal sodium/bile acid cotransporter with an apical cell localization that absorbs bile acids from the intestinal lumen, bile duct and kidney, and the liver-specific sodium/bile acid cotransporter, represented by this protein, that is found in the basolateral membranes of hepatocytes. Bile acids are the catabolic product of cholesterol metabolism, hence this protein is important for cholesterol homeostasis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
