-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of mus musculus GLI2 (NP_001074594.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GLI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of mus musculus GLI2 (NP_001074594.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10707A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLI2 |
| Target Synonyms | GLI2; CJS; HPE9; PHS2; THP1; THP2; Gli2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Mouse brain, Mouse lung, Mouse ovary, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of mus musculus GLI2 (NP_001074594.1). | Immunogen Sequence | METSAPAPALEKKEAKSGLLEDSSFPDPGKKACPLAVAAAVAAHGVPQQLLPAFHAPLPIDMRHQEGRYHYDPHSVHSVHGPPTLSGSPVISDISLIRLSPHPAGPGESPFSAHHPYVNPHMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPGTNPSDYYHQ |
|---|---|---|---|
| Uniprot ID | P10070 |
Uniprot Id
P10070
Target Species
Human
Target Name
GLI2
Target Full Name
Zinc finger protein GLI2
Target Function
Functions as transcription regulator in the hedgehog (Hh) pathway. Functions as transcriptional activator. May also function as transcriptional repressor. Requires STK36 for full transcriptional activator activity. Required for normal embryonic development.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Acts as a transcriptional activator in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; Acts as a transcriptional repressor.
Target Involvement
Holoprosencephaly 9 (HPE9); Culler-Jones syndrome (CJS)
Target Subcellular Location
Nucleus. Cytoplasm. Cell projection, cilium.; [Isoform 1]: Nucleus.; [Isoform 2]: Nucleus.
Target Protein Families
GLI C2H2-type zinc-finger protein family
Target Tissue Specificity
Expressed in breast cancers (at protein level). Isoform 1 and isoform 4 are expressed in HTLV-1-infected T-cell lines (at protein level). Isoform 1 and isoform 2 are strongly expressed in HTLV-1-infected T-cell lines. Isoform 3 and isoform 4 are weakly ex
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CJS; Gli 2; GLI family zinc finger 2; GLI Kruppel family member GLI2; GLI2; GLI2_HUMAN; Glioma associated oncogene family zinc finger; HPE9; Oncogene GLI2; PHS2; Tax helper protein 1; Tax helper protein 2; Tax helper protein; Tax responsive element 2 holding protein; Tax responsive element 25 bp sequence binding protein; THP; THP1; THP2; Zinc finger protein GLI2
Target Background
Enables DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and promoter-specific chromatin binding activity. Acts upstream of or within several processes, including animal organ development; chordate embryonic development; and regulation of smoothened signaling pathway. Located in several cellular components, including axoneme; ciliary tip; and nuclear speck. Is expressed in several structures, including central nervous system; embryo mesenchyme; eye; genitourinary system; and jaw. Human ortholog(s) of this gene implicated in Culler-Jones syndrome; holoprosencephaly 9; and spina bifida. Orthologous to human GLI2 (GLI family zinc finger 2).
Notification