Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADAM23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human ADAM23 (NP_003803.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADAM23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human ADAM23 (NP_003803.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00668A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADAM23 |
| Target Synonyms | MDC3; MDC-3; ADAM23 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, 293T, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human ADAM23 (NP_003803.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLF | Uniprot ID | O75077 |
Uniprot Id
O75077
Target Species
Human
Target Name
ADAM23
Target Full Name
Disintegrin and metalloproteinase domain-containing protein 23
Target Function
May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform Gamma]: Secreted.
Target Tissue Specificity
Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole.
Target Synonyms
ADAM23; MDC3; Disintegrin and metalloproteinase domain-containing protein 23; ADAM 23; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3; MDC-3
Target Background
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. It is reported that inactivation of this gene is associated with tumorigenesis in human cancers.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
