-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-345 of human ADK (NP_001114.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ADK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-345 of human ADK (NP_001114.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05309A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADK |
| Target Synonyms | AK; ADK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-431, LO2, Mouse spleen, Mouse testis, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-345 of human ADK (NP_001114.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH | Uniprot ID | P55263 |
Uniprot Id
P55263
Target Species
Human
Target Name
ADK
Target Full Name
Adenosine kinase
Target Function
ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. Serves as a potential regulator of concentrations of extracellular adenosine and intracellular adenine nucleotides.
Target Involvement
Hypermethioninemia due to adenosine kinase deficiency (HMAKD)
Target Subcellular Location
[Isoform 1]: Nucleus.; [Isoform 2]: Cytoplasm.
Target Protein Families
Carbohydrate kinase PfkB family
Target Tissue Specificity
Widely expressed. Highest level in placenta, liver, muscle and kidney.
Target Synonyms
2310026J05Rik; 5033405D03Rik; Adenosine 5''-phosphotransferase; Adenosine kinase; adk; ADK_HUMAN; AI255373; AI987814; AK; MGC6593; OTTHUMP00000019864; OTTHUMP00000019865
Target Background
This gene an enzyme which catalyzes the transfer of the gamma-phosphate from ATP to adenosine, thereby serving as a regulator of concentrations of both extracellular adenosine and intracellular adenine nucleotides. Adenosine has widespread effects on the cardiovascular, nervous, respiratory, and immune systems and inhibitors of the enzyme could play an important pharmacological role in increasing intravascular adenosine concentrations and acting as anti-inflammatory agents. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification