Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADORA2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ADORA2B (NP_000667.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ADORA2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ADORA2B (NP_000667.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09930A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADORA2B |
| Target Synonyms | ADORA2; ADORA2B | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ADORA2B (NP_000667.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLV | Uniprot ID | P29275 |
Uniprot Id
P29275
Target Species
Human
Target Name
ADORA2B
Target Full Name
Adenosine receptor A2b
Target Function
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
ADORA2B; Adenosine receptor A2b
Target Background
This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
