-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALIX / PDCD6IP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ALIX / PDCD6IP (NP_037506.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ALIX / PDCD6IP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ALIX / PDCD6IP (NP_037506.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12892A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALIX / PDCD6IP |
| Target Synonyms | AIP1; ALIX; HP95; DRIP4; MCPH29; ALIX / PDCD6IP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Jurkat, LO2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ALIX / PDCD6IP (NP_037506.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDIS | Uniprot ID | Q8WUM4 |
Uniprot Id
Q8WUM4
Target Species
Human
Target Name
PDCD6IP
Target Full Name
Programmed cell death 6-interacting protein
Target Function
Multifunctional protein involved in endocytosis, multivesicular body biogenesis, membrane repair, cytokinesis, apoptosis and maintenance of tight junction integrity. Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. Binds to the phospholipid lysobisphosphatidic acid (LBPA) which is abundant in MVBs internal membranes. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complexes. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. Required for completion of cytokinesis. May play a role in the regulation of both apoptosis and cell proliferation. Regulates exosome biogenesis in concert with SDC1/4 and SDCBP. By interacting with F-actin, PARD3 and TJP1 secures the proper assembly and positioning of actomyosin-tight junction complex at the apical sides of adjacent epithelial cells that defines a spatial membrane domain essential for the maintenance of epithelial cell polarity and barrier.; (Microbial infection) Involved in HIV-1 virus budding. Can replace TSG101 it its role of supporting HIV-1 release; this function requires the interaction with CHMP4B. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as enveloped virus budding (HIV-1 and other lentiviruses).
Target Subcellular Location
Cytoplasm, cytosol. Melanosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Secreted, extracellular exosome. Cell junction, tight junction. Midbody, Midbody ring.
Target Synonyms
AIP1; ALG 2 interacting protein 1; ALG-2-interacting protein 1; ALG2 interacting protein X; Alix; Apoptosis linked gene 2 interacting protein X; Dopamine receptor interacting protein 4; DRIP4; Hp95; KIAA1375; MGC17003; PDC6I_HUMAN; PDCD6 interacting protein; PDCD6-interacting protein; PDCD6IP; Programmed cell death 6 interacting protein; Programmed cell death 6-interacting protein
Target Background
This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15.
Notification