-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANAPC10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human ANAPC10 (NP_055700.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANAPC10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human ANAPC10 (NP_055700.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01512A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANAPC10 |
| Target Synonyms | DOC1; APC10; ANAPC10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, 293T, Jurkat, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human ANAPC10 (NP_055700.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR | Uniprot ID | Q9UM13 |
Uniprot Id
Q9UM13
Target Species
Human
Target Name
ANAPC10
Target Full Name
Anaphase-promoting complex subunit 10
Target Function
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Target Protein Families
APC10 family
Target Research Area
Cell Biology
Target Synonyms
ANAPC 10; anapc10; Anaphase promoting complex 10; Anaphase promoting complex subunit 10; Anaphase-promoting complex subunit 10; Apc 10; APC10; APC10_HUMAN; Cyclosome subunit 10; DKFZP564L0562; Doc 1; Doc1; Doc1; S. cerevisiae; homolog of; OTTHUMP00000220297; OTTHUMP00000220298; OTTHUMP00000220299; OTTHUMP00000220300; OTTHUMP00000220303
Target Background
ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).
Notification