-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANAPC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human ANAPC2 (NP_037498.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ANAPC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human ANAPC2 (NP_037498.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11735A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANAPC2 |
| Target Synonyms | APC2; ANAPC2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brian, Rat brian, Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human ANAPC2 (NP_037498.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPGKSSSKRRSSD | Uniprot ID | Q9UJX6 |
Uniprot Id
Q9UJX6
Target Species
Human
Target Name
ANAPC2
Target Full Name
Anaphase-promoting complex subunit 2
Target Function
Together with the RING-H2 protein ANAPC11, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 drives presynaptic differentiation.
Target Protein Families
Cullin family
Target Synonyms
anapc2; Anaphase promoting complex subunit 2; Anaphase-promoting complex subunit 2; ANC2_HUMAN; APC2; Cyclosome subunit 2; KIAA1406; OTTHUMP00000022692; RP11 350O14.5
Target Background
A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The product of this gene is a component of the complex and shares sequence similarity with a recently identified family of proteins called cullins, which may also be involved in ubiquitin-mediated degradation.
Notification