Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human ANO1 (NP_060513.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ANO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human ANO1 (NP_060513.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12293A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANO1 |
| Target Synonyms | DOG1; INDMS; TAOS2; ORAOV2; TMEM16A; ANO1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HCT116 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human ANO1 (NP_060513.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVK | Uniprot ID | Q5XXA6 |
Uniprot Id
Q5XXA6
Target Species
Human
Target Name
ANO1
Target Full Name
Anoctamin-1
Target Function
Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm.
Target Protein Families
Anoctamin family
Target Tissue Specificity
Broadly expressed with higher levels in liver, skeletal muscle and gastrointestinal muscles.
Target Research Area
Tags & Cell Markers
Target Synonyms
ANO 1; ANO1; ANO1_HUMAN; Anoctamin 1; Anoctamin 1 calcium activated chloride channel; Anoctamin-1; Anoctamin1; Ca2+ activated Cl- channel; Calcium Activated Chloride Channel; Discovered on gastrointestinal stromal tumors protein 1; DOG 1; DOG1; FLJ10261; Membrane protein; Oral cancer overexpressed 2; Oral cancer overexpressed protein 2; ORAOV 2; ORAOV2; TAOS 2; TAOS2; TMEM 16A; TMEM16A; Transmembrane protein 16A (eight membrane spanning domains); Transmembrane protein 16A; Tumor amplified and overexpressed sequence 2; Tumor-amplified and overexpressed sequence 2
Target Background
Enables calcium activated cation channel activity; intracellular calcium activated chloride channel activity; and iodide transmembrane transporter activity. Involved in cation transport; inorganic anion transport; and positive regulation of insulin secretion involved in cellular response to glucose stimulus. Located in apical plasma membrane and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
