Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human ATG2A (NP_055919.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATG2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human ATG2A (NP_055919.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01165A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG2A |
| Target Synonyms | BLTP4A; ATG2A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ATG2A (NP_055919.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLHGIYEDGGKPPVPCLRVSKALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSKRTMYETEEMVIPGDPEEMRT | Uniprot ID | Q2TAZ0 |
Uniprot Id
Q2TAZ0
Target Species
Human
Target Name
ATG2A
Target Full Name
Autophagy-related protein 2 homolog A
Target Function
Lipid transfer protein involved in autophagosome assembly. Tethers the edge of the isolation membrane (IM) to the endoplasmic reticulum (ER) and mediates direct lipid transfer from ER to IM for IM expansion. Binds to the ER exit site (ERES), which is the membrane source for autophagosome formation, and extracts phospholipids from the membrane source and transfers them to ATG9 (ATG9A or ATG9B) to the IM for membrane expansion. Lipid transfer activity is enhanced by WIPI1 and WDR45/WIPI4, which promote ATG2A-association with phosphatidylinositol 3-monophosphate (PI3P)-containing membranes. Also regulates lipid droplets morphology and distribution within the cell
Target Subcellular Location
Preautophagosomal structure membrane; Peripheral membrane protein. Lipid droplet. Endoplasmic reticulum membrane; Peripheral membrane protein.
Target Protein Families
ATG2 family
Target Synonyms
1810013C15Rik; A830054M12; ATG2 autophagy related 2 homolog A (S. cerevisiae); ATG2A; ATG2A_HUMAN; Autophagy-related protein 2 homolog A; BC023754; KIAA0404; MGC117153; MGC67447; mKIAA0404
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
