Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATOH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 215-354 of human ATOH1 (NP_005163.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATOH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 215-354 of human ATOH1 (NP_005163.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11801A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Atoh1 |
| Target Synonyms | ATH1; HATH1; DFNA89; MATH-1; bHLHa14; ATOH1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2, human pacenta, Mouse liver, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 215-354 of human ATOH1 (NP_005163.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS | Uniprot ID | Q92858 |
Uniprot Id
Q92858
Target Species
Human
Target Name
ATOH1
Target Full Name
Transcription factor ATOH1
Target Function
Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Target Subcellular Location
Nucleus.
Target Research Area
Epigenetics and Nuclear Signaling, Developmental Biology
Target Synonyms
ATH1; ATOH1; ATOH1_HUMAN; Atonal homolog 1 (Drosophila); Atonal homolog 1; bHLHa14; Class A basic helix-loop-helix protein 14; hATH1; Helix loop helix protein hATH 1; Helix-loop-helix protein hATH-1; MATH 1; MATH1; Protein atonal homolog 1
Target Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in neuron differentiation; positive regulation of neuron differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including generation of neurons; inner ear morphogenesis; and positive regulation of inner ear auditory receptor cell differentiation. Predicted to be part of chromatin. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
