Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP2B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ATP2B1 (NP_001673.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ATP2B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ATP2B1 (NP_001673.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10991A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP2B1 |
| Target Synonyms | MRD66; PMCA1; PMCA1kb; ATP2B1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ATP2B1 (NP_001673.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGE | Uniprot ID | P20020 |
Uniprot Id
P20020
Target Species
Human
Target Name
ATP2B1
Target Full Name
Plasma membrane calcium-transporting ATPase 1
Target Function
Catalyzes the hydrolysis of ATP coupled with the transport of calcium from the cytoplasm to the extracellular space thereby maintaining intracellular calcium homeostasis. Plays a role in blood pressure regulation through regulation of intracellular calcium concentration and nitric oxide production leading to regulation of vascular smooth muscle cells vasoconstriction. Positively regulates bone mineralization through absorption of calcium from the intestine. Plays dual roles in osteoclast differentiation and survival by regulating RANKL-induced calcium oscillations in preosteoclasts and mediating calcium extrusion in mature osteoclasts. Regulates insulin sensitivity through calcium/calmodulin signaling pathway by regulating AKT1 activation and NOS3 activation in endothelial cells. May play a role in synaptic transmission by modulating calcium and proton dynamics at the synaptic vesicles
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane. Cell junction, synapse. Cell junction, synapse, presynaptic cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein.
Target Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IIB subfamily
Target Tissue Specificity
Isoform B: Ubiquitously expressed. Isoform C: Found in brain cortex, skeletal muscle and heart muscle. Isoform D: Has only been found in fetal skeletal muscle. Isoform K: Found in small intestine and liver. Abundantly expressed in the endometrial epitheli
Target Synonyms
AT2B1_HUMAN; ATP2B1; ATPase Ca++ transporting plasma membrane 1; Plasma membrane calcium ATPase 1; Plasma membrane calcium ATPase isoform 1; Plasma membrane calcium pump isoform 1; Plasma membrane calcium transporting ATPase 1; Plasma membrane calcium-transporting ATPase 1; PMCA 1; PMCA1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
